Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLPBP Peptide - C-terminal region

PLPBP Peptide - C-terminal region

Product Specifications

Product Name Alternative

PROSC, EPVB6D

UniProt

O94903

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLPBP Rabbit Polyclonal Antibody (orb585312) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009129

Preservative

Lyophilized powder

AA Sequence

PADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKKPTPDKCAAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TKTL2 activation kit by CRISPRa
GA113360 1 Kit

Human TKTL2 activation kit by CRISPRa

Sign In for Pricing
View Details
Atox1 Mouse Gene Knockout Kit (CRISPR)
KN501755 1 Kit

Atox1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC25A17 (NM_001282726) Human Tagged ORF Clone
RG237060 10 µg

SLC25A17 (NM_001282726) Human Tagged ORF Clone

Sign In for Pricing
View Details
AMPK gamma 1 (PRKAG1) (N-term) Rabbit Polyclonal Antibody
AP53443PU-N 400 µL

AMPK gamma 1 (PRKAG1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM90A7P (NM_001136572) Human Over-expression Lysate
LY427928 100 µg

FAM90A7P (NM_001136572) Human Over-expression Lysate

Sign In for Pricing
View Details
Myristic Acid (D27, 98%)
TRC-M884625-10MG 10 mg

Myristic Acid (D27, 98%)

Sign In for Pricing
View Details