Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF18 Peptide - N-terminal region

PRPF18 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ10210, PRP18, hPrp18

UniProt

Q99633

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRPF18 Rabbit Polyclonal Antibody (orb585463) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003666

Preservative

Lyophilized powder

AA Sequence

KRQLVEDRNLLVENKKYFKRSELAKKEEEAYFERCGYKIQPKEEDQKPLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLINT1 (Clathrin Interactor 1, ENTH, EPN4, EPNR, CLINT) (HRP)
MBS6411892-01 0.1 mL

CLINT1 (Clathrin Interactor 1, ENTH, EPN4, EPNR, CLINT) (HRP)

Sign In for Pricing
View Details
CLINT1 (Clathrin Interactor 1, ENTH, EPN4, EPNR, CLINT) (HRP)
MBS6411892-02 5x 0.1 mL

CLINT1 (Clathrin Interactor 1, ENTH, EPN4, EPNR, CLINT) (HRP)

Sign In for Pricing
View Details
Furin shRNA Plasmid (h)
sc-40595-SH 20 µg

Furin shRNA Plasmid (h)

Sign In for Pricing
View Details
Potassium acetate, 98%
GX7641-1kg 1 Kg

Potassium acetate, 98%

Sign In for Pricing
View Details
KCNIP3 Antibody
orb1248692 0.1 mg

KCNIP3 Antibody

Sign In for Pricing
View Details
SMAD7 (SMAD Family Member 7, CRCS3, FLJ16482, MADH7, MADH8) (MaxLight 490)
MBS6208612-01 0.1 mL

SMAD7 (SMAD Family Member 7, CRCS3, FLJ16482, MADH7, MADH8) (MaxLight 490)

Sign In for Pricing
View Details