Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRR13 Peptide - N-terminal region

PRR13 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp564J157, FLJ23818, TXR1

UniProt

Q9NZ81

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRR13 Rabbit Polyclonal Antibody (orb583497) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060927

Preservative

Lyophilized powder

AA Sequence

MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL3, Human
E34M129H 5 µg

CCL3, Human

Sign In for Pricing
View Details
Akirin1 Antibody
4801-01mg 0.1 mg

Akirin1 Antibody

Sign In for Pricing
View Details
NTSR1 Protein Vector (Mouse) (pPB-N-His)
PV207075 500 ng

NTSR1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
ATP6V0B Antibody
E51A11979 100 µL

ATP6V0B Antibody

Sign In for Pricing
View Details
HS2ST1 Blocking Peptide
33R-3410 0.1 mg

HS2ST1 Blocking Peptide

Sign In for Pricing
View Details
H-p-Bromo-DL-Phe-OH
4007001.0025 25 g

H-p-Bromo-DL-Phe-OH

Sign In for Pricing
View Details