Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRR13 Peptide - N-terminal region

PRR13 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp564J157, FLJ23818, TXR1

UniProt

Q9NZ81

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRR13 Rabbit Polyclonal Antibody (orb583497) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060927

Preservative

Lyophilized powder

AA Sequence

MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPIC Recombinant Protein
OPCD06345-200UG 200 µg

PPIC Recombinant Protein

Sign In for Pricing
View Details
NR2E1 siRNA (Mouse)
MBS8232413-01 15 nmol

NR2E1 siRNA (Mouse)

Sign In for Pricing
View Details
NR2E1 siRNA (Mouse)
MBS8232413-02 30 nmol

NR2E1 siRNA (Mouse)

Sign In for Pricing
View Details
NR2E1 siRNA (Mouse)
MBS8232413-03 5x 30 nmol

NR2E1 siRNA (Mouse)

Sign In for Pricing
View Details
Mapk12 Knockout RAW 264.7 Polyclonal Cells
ARG12502 1 Million

Mapk12 Knockout RAW 264.7 Polyclonal Cells

Sign In for Pricing
View Details
OR8G2 CRISPRa sgRNA lentivector (set of three targets)(Human)
35668121 3x 1.0µg DNA

OR8G2 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details