Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRR5 Peptide - N-terminal region

PRR5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20185, FLJ20185k, PP610, PROTOR1, PROTOR-1

UniProt

B3KRM4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRR5 Rabbit Polyclonal Antibody (orb583296) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056181

Preservative

Lyophilized powder

AA Sequence

NSIHNGVIAVFQRKGLPDQELFSLNEGVRQLLKTELGSFFTEYLQNQLLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD84 (NM_001184881) Human Recombinant Protein
TP329804L 1 mg

CD84 (NM_001184881) Human Recombinant Protein

Sign In for Pricing
View Details
OR10G9 (C-term) Rabbit Polyclonal Antibody
AP53006PU-N 400 µL

OR10G9 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3398), CF488A conjugate, 0.1mg/mL
BNC883398-100 1x 100 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3398), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Gliomedin (GLDN) activation kit by CRISPRa
GA117528 1 Kit

Human Gliomedin (GLDN) activation kit by CRISPRa

Sign In for Pricing
View Details
ABHD11 (Center) Rabbit Polyclonal Antibody
AP50028PU-N 400 µL

ABHD11 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
XKR6 Human Gene Knockout Kit (CRISPR)
KN416120 1 Kit

XKR6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details