Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRR5 Peptide - N-terminal region

PRR5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20185, FLJ20185k, PP610, PROTOR1, PROTOR-1

UniProt

B3KRM4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRR5 Rabbit Polyclonal Antibody (orb583296) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056181

Preservative

Lyophilized powder

AA Sequence

NSIHNGVIAVFQRKGLPDQELFSLNEGVRQLLKTELGSFFTEYLQNQLLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amy2a2 Mouse Gene Knockout Kit (CRISPR)
KN501211 1 Kit

Amy2a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (Ab-38) Antibody
8B1205-AAT 50 µg

GFAP (Ab-38) Antibody

Sign In for Pricing
View Details
LED OR shadowless lamp BOPL-604
BOPL-604 1 Unit

LED OR shadowless lamp BOPL-604

Sign In for Pricing
View Details
FAM13A (NM_001015045) Human Over-expression Lysate
LY423113 100 µg

FAM13A (NM_001015045) Human Over-expression Lysate

Sign In for Pricing
View Details
DCP1A Human Gene Knockout Kit (CRISPR)
KN401330 1 Kit

DCP1A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details