Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrg3 Peptide - N-terminal region

Prrg3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Gm368

UniProt

Q6PAQ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prrg3 Rabbit Polyclonal Antibody (orb580872) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074604

Preservative

Lyophilized powder

AA Sequence

MAVFLEAKNAHAVLKRFPRANEFLEELRQGTIERECMEEICSYEEVKEVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AZD-5991
BA3330-1 1 mg

AZD-5991

Sign In for Pricing
View Details
ZNF212 Antibody
A38786-100UG 100 µg

ZNF212 Antibody

Sign In for Pricing
View Details
Anti-ARRB1 Rabbit Monoclonal Antibody
MA1307-.05 50 µL

Anti-ARRB1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Probable tubulin polyglutamylase TTLL9, Ttll9 ELISA KIT
ELI-28408m 96 Tests

Mouse Probable tubulin polyglutamylase TTLL9, Ttll9 ELISA KIT

Sign In for Pricing
View Details
SOCS3 Rabbit Polyclonal Antibody (FITC)
orb463602 100 µL

SOCS3 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
DCC CRISPRa sgRNA lentivector (set of three targets)(Human)
17717121 3x 1.0µg DNA

DCC CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details