Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrg3 Peptide - N-terminal region

Prrg3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Gm368

UniProt

Q6PAQ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prrg3 Rabbit Polyclonal Antibody (orb580872) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074604

Preservative

Lyophilized powder

AA Sequence

MAVFLEAKNAHAVLKRFPRANEFLEELRQGTIERECMEEICSYEEVKEVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSBP3 Protein Vector (Mouse) (pPM-C-HA)
PV234144 500 ng

SSBP3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
ADRA2C ORF Vector (Human) (pORF)
ORF015344 1.0 µg DNA

ADRA2C ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
DNM1P26 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV760049 1.0 µg DNA

DNM1P26 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
KIAA1310 (KANSL3) Human shRNA Plasmid Kit (Locus ID 55683)
TL307083 1 Kit

KIAA1310 (KANSL3) Human shRNA Plasmid Kit (Locus ID 55683)

Sign In for Pricing
View Details
IRAK1 Protein Vector (Rat) (pPB-N-His)
PV274939 500 ng

IRAK1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
TAPS Buffer 0.2M, pH 8.0
NBB-2370-01 100 mL

TAPS Buffer 0.2M, pH 8.0

Sign In for Pricing
View Details