Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrg4 Peptide - N-terminal region

Prrg4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

9930111I18Rik, MGC117538, TMG4

UniProt

Q8BGN6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prrg4 Rabbit Polyclonal Antibody (orb580871) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848810

Preservative

Lyophilized powder

AA Sequence

CIRSLKDSEHAPEEVFASKEAANIFMHRRLLNNRFDLELFTPGDLERECY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex H5N1/H7N7/N9N2
MulOneq-V867-50D 50 Reactions

Multiplex H5N1/H7N7/N9N2

Sign In for Pricing
View Details
ANKRD37 siRNA (Mouse)
MBS8204802-01 15 nmol

ANKRD37 siRNA (Mouse)

Sign In for Pricing
View Details
ANKRD37 siRNA (Mouse)
MBS8204802-02 30 nmol

ANKRD37 siRNA (Mouse)

Sign In for Pricing
View Details
ANKRD37 siRNA (Mouse)
MBS8204802-03 5x 30 nmol

ANKRD37 siRNA (Mouse)

Sign In for Pricing
View Details
SLC10A6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2166507 1.0 µg DNA

SLC10A6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Mouse Tyrosine-protein kinase receptor UFO/Axl Protein
E901566P 10 µg

Recombinant Mouse Tyrosine-protein kinase receptor UFO/Axl Protein

Sign In for Pricing
View Details