Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrxl1 Peptide - C-terminal region

Prrxl1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Drg11, Drgx

UniProt

Q8BYH0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prrxl1 Rabbit Polyclonal Antibody (orb324743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001001796

Preservative

Lyophilized powder

AA Sequence

PSCLPGTLLNTATYAQALSHVASLKDHFRAMLCSGSFGFRGEQTQQRALT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glipr2 3'UTR GFP Stable Cell Line
TU157118 1.0 mL

Glipr2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Ascc1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7191402 1.0 µg DNA

Ascc1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
DUSP13, NT (M1) (Dual Specificity Protein Phosphatase 13, Testis-and Skeletal-muscle-specific DSP, Dual Specificity Phosphatase SKRP4, TMDP)
D9840-46B 200 µL

DUSP13, NT (M1) (Dual Specificity Protein Phosphatase 13, Testis-and Skeletal-muscle-specific DSP, Dual Specificity Phosphatase SKRP4, TMDP)

Sign In for Pricing
View Details
EFEMP1 Protein Vector (Rat) (pPM-C-HA)
PV265516 500 ng

EFEMP1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
CCR1 antagonist 13
HY-124668A 1 Each

CCR1 antagonist 13

Sign In for Pricing
View Details
DAB1 Rabbit pAb
E45R17973N 50 ul

DAB1 Rabbit pAb

Sign In for Pricing
View Details