Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS1 Peptide - N-terminal region

PRSS1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC120175, MGC149362, TRP1, TRY1, TRY4, TRYP1

UniProt

P07477

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS1 Rabbit Polyclonal Antibody (orb584857) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002760

Preservative

Lyophilized powder

AA Sequence

LILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLIN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Her2 (ERBB2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A1]
TA505818AM 100 µL

Her2 (ERBB2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A1]

Sign In for Pricing
View Details
2-Pyridineethanol
TRC-P991520-5G 5 g

2-Pyridineethanol

Sign In for Pricing
View Details
INPP4A Recombinant Rabbit Monoclonal Antibody [PSH01-27]
HA721651 100 µL

INPP4A Recombinant Rabbit Monoclonal Antibody [PSH01-27]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB527514 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Desmoglein-3 (Squamous Cell Marker) (DSG3/2840), CF647 conjugate, 0.1mg/mL
BNC472840-100 1x 100 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2840), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MGST3 Antibody
8C16642-AAT 50 µg

MGST3 Antibody

Sign In for Pricing
View Details