Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS22 Peptide - N-terminal region

PRSS22 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BSSP-4, MGC9599, SP001LA, hBSSP-4

UniProt

Q9GZN4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS22 Rabbit Polyclonal Antibody (orb583632) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071402

Preservative

Lyophilized powder

AA Sequence

IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MyoGEF (PLEKHG6) (NM_001144857) Human Recombinant Protein
TP327365 20 µg

MyoGEF (PLEKHG6) (NM_001144857) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB510920 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
ITPR3 Polyclonal Antibody
E-AB-13346-01 20 µL

ITPR3 Polyclonal Antibody

Sign In for Pricing
View Details
ITPR3 Polyclonal Antibody
E-AB-13346-02 60 µL

ITPR3 Polyclonal Antibody

Sign In for Pricing
View Details
ITPR3 Polyclonal Antibody
E-AB-13346-03 120 µL

ITPR3 Polyclonal Antibody

Sign In for Pricing
View Details
ITPR3 Polyclonal Antibody
E-AB-13346-04 200 µL

ITPR3 Polyclonal Antibody

Sign In for Pricing
View Details