Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS23 Peptide - C-terminal region

PRSS23 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC5107, SIG13, SPUVE, ZSIG13

UniProt

O95084

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS23 Rabbit Polyclonal Antibody (orb581652) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009104

Preservative

Lyophilized powder

AA Sequence

VSPPAKQLPGGRIHFSGYDNDRPGNLVYRFCDVKDETYDLLYQQCDAQPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Kidney
CR559503 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
QKI-6 Recombinant Mouse monoclonal Antibody
HA610224 100 µg

QKI-6 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Casd1 Mouse Gene Knockout Kit (CRISPR)
KN502558 1 Kit

Casd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF640R conjugate, 0.1mg/mL
BNC401384-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phospho-IKB alpha (S32/S36) Recombinant Rabbit monoclonal Antibody
HA751119 100 µL

Phospho-IKB alpha (S32/S36) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
DAF-FM diacetate
16298-AAT 10x 50 µg

DAF-FM diacetate

Sign In for Pricing
View Details