Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS23 Peptide - C-terminal region

PRSS23 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC5107, SIG13, SPUVE, ZSIG13

UniProt

O95084

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS23 Rabbit Polyclonal Antibody (orb581652) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009104

Preservative

Lyophilized powder

AA Sequence

VSPPAKQLPGGRIHFSGYDNDRPGNLVYRFCDVKDETYDLLYQQCDAQPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

beta 1 Sodium Potassium ATPase (ATP1B1) Human Gene Knockout Kit (CRISPR)
KN400500 1 Kit

beta 1 Sodium Potassium ATPase (ATP1B1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Isotype Control, Mouse IgG1 Kappa (IGG1/1331), APC Conjugate, 0.1 mg/mL
BNCA1331-250 1x 250 µL

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), APC Conjugate, 0.1 mg/mL

Sign In for Pricing
View Details
GLYATL2 Rabbit Polyclonal Antibody
TA366192 100 µL

GLYATL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
m-Nitrobenzoic-d4 Acid
TRC-N494702-10MG 10 mg

m-Nitrobenzoic-d4 Acid

Sign In for Pricing
View Details
CD74 (B-Cell Marker) (CLIP/3127R), CF647 conjugate, 0.1mg/mL
BNC473127-500 1x 500 µL

CD74 (B-Cell Marker) (CLIP/3127R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NR2C2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B1]
TA807247BM 100 µL

NR2C2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B1]

Sign In for Pricing
View Details