Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS8 Peptide - middle region

PRSS8 Peptide - middle region

Product Specifications

Product Name Alternative

CAP1, PROSTASIN

UniProt

Q16651

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS8 Rabbit Polyclonal Antibody (orb583166) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002764

Preservative

Lyophilized powder

AA Sequence

PITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLE

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quick Step Chicken Amylase Alpha 2a (AMY2A) elisa Kit
QS0221Ch-01 48 Tests

Quick Step Chicken Amylase Alpha 2a (AMY2A) elisa Kit

Sign In for Pricing
View Details
Quick Step Chicken Amylase Alpha 2a (AMY2A) elisa Kit
QS0221Ch-02 96 Tests

Quick Step Chicken Amylase Alpha 2a (AMY2A) elisa Kit

Sign In for Pricing
View Details
RNASE4 (NM_002937) Human Tagged ORF Clone
RG220443 10 µg

RNASE4 (NM_002937) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human ZDHHC20 Protein Lysate
MBS8430078-01 0.02 mg

Human ZDHHC20 Protein Lysate

Sign In for Pricing
View Details
Human ZDHHC20 Protein Lysate
MBS8430078-02 5x 0.02 mg

Human ZDHHC20 Protein Lysate

Sign In for Pricing
View Details
GMFG Polyclonal Antibody, RBITC Conjugated
bs-13457R-RBITC 100 µL

GMFG Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details