Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS8 Peptide - middle region

PRSS8 Peptide - middle region

Product Specifications

Product Name Alternative

CAP1, PROSTASIN

UniProt

Q16651

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS8 Rabbit Polyclonal Antibody (orb583166) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002764

Preservative

Lyophilized powder

AA Sequence

PITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLE

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (1-Amino-2,3-dimethyl-1-oxobutan-2-yl) -2- (5-isopropyl-5-methyl-4-oxo-4,5-dihydro-1H-imidazol-2-yl) -5- (methoxymethyl) nicotinamide
165071 25 mg

N- (1-Amino-2,3-dimethyl-1-oxobutan-2-yl) -2- (5-isopropyl-5-methyl-4-oxo-4,5-dihydro-1H-imidazol-2-yl) -5- (methoxymethyl) nicotinamide

Sign In for Pricing
View Details
Frizzled 10 (FZD10) Rabbit Polyclonal Antibody
TA344071 100 µL

Frizzled 10 (FZD10) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE Anti-human CD4 Antibody *OKT-4*
100431L1-AAT 100 Tests

PE Anti-human CD4 Antibody *OKT-4*

Sign In for Pricing
View Details
Human Ornithine Decarboxylase (ODC) ELISA Kit
EKU06405 96 Tests

Human Ornithine Decarboxylase (ODC) ELISA Kit

Sign In for Pricing
View Details
LPL discontinued
531045-01 20 µL

LPL discontinued

Sign In for Pricing
View Details
LPL discontinued
531045-02 100 µL

LPL discontinued

Sign In for Pricing
View Details