Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Psenen Peptide - N-terminal region

Psenen Peptide - N-terminal region

Product Specifications

Product Name Alternative

1700023M09Rik, MGC102026

UniProt

Q9CQR7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Psenen Rabbit Polyclonal Antibody (orb584333) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079774

Preservative

Lyophilized powder

AA Sequence

LGGFAFLPFLWLVNIFWFFREAFLAPAYTEQSQIKGYVWRSAVGFLFWVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppp4r1 ORF Vector (Mouse) (pORF)
ORF054694 1.0 µg DNA

Ppp4r1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Mouse Death domain-containing protein CRADD (Cradd)
MBS1028923-01 0.02 mg (E-Coli)

Recombinant Mouse Death domain-containing protein CRADD (Cradd)

Sign In for Pricing
View Details
Recombinant Mouse Death domain-containing protein CRADD (Cradd)
MBS1028923-02 0.1 mg (E-Coli)

Recombinant Mouse Death domain-containing protein CRADD (Cradd)

Sign In for Pricing
View Details
Recombinant Mouse Death domain-containing protein CRADD (Cradd)
MBS1028923-03 0.02 mg (Yeast)

Recombinant Mouse Death domain-containing protein CRADD (Cradd)

Sign In for Pricing
View Details
Recombinant Mouse Death domain-containing protein CRADD (Cradd)
MBS1028923-04 0.1 mg (Yeast)

Recombinant Mouse Death domain-containing protein CRADD (Cradd)

Sign In for Pricing
View Details
Recombinant Mouse Death domain-containing protein CRADD (Cradd)
MBS1028923-05 0.02 mg (Baculovirus)

Recombinant Mouse Death domain-containing protein CRADD (Cradd)

Sign In for Pricing
View Details