Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Psenen Peptide - N-terminal region

Psenen Peptide - N-terminal region

Product Specifications

Product Name Alternative

1700023M09Rik, MGC102026

UniProt

Q9CQR7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Psenen Rabbit Polyclonal Antibody (orb584333) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079774

Preservative

Lyophilized powder

AA Sequence

LGGFAFLPFLWLVNIFWFFREAFLAPAYTEQSQIKGYVWRSAVGFLFWVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Ligase IV Polyclonal Antibody
JOT-AP02654-01 20 µL

DNA Ligase IV Polyclonal Antibody

Sign In for Pricing
View Details
DNA Ligase IV Polyclonal Antibody
JOT-AP02654-02 50 μL

DNA Ligase IV Polyclonal Antibody

Sign In for Pricing
View Details
DNA Ligase IV Polyclonal Antibody
JOT-AP02654-03 100 µL

DNA Ligase IV Polyclonal Antibody

Sign In for Pricing
View Details
Lyophilized Exosome (Human Urine)
EXA-0822-CY6 2 Vials (> 1x 10^8 PaRoom Temperatureicles/Vial)

Lyophilized Exosome (Human Urine)

Sign In for Pricing
View Details
Ataxin 1 (ATXN1) Antibody
abx431572 200 µL

Ataxin 1 (ATXN1) Antibody

Sign In for Pricing
View Details
Human CLDN6 OV90 Cell Line
E24C00237 1 Vial

Human CLDN6 OV90 Cell Line

Sign In for Pricing
View Details