Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Psmc1 Peptide - C-terminal region

Psmc1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI325227, P26s4, S4

UniProt

P62192

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Psmc1 Rabbit Polyclonal Antibody (orb583178) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032973

Preservative

Lyophilized powder

AA Sequence

ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon Tenascin C ELISA Kit
MBS098627-01 48 Well

Pigeon Tenascin C ELISA Kit

Sign In for Pricing
View Details
Pigeon Tenascin C ELISA Kit
MBS098627-02 96 Well

Pigeon Tenascin C ELISA Kit

Sign In for Pricing
View Details
Pigeon Tenascin C ELISA Kit
MBS098627-03 5x 96 Well

Pigeon Tenascin C ELISA Kit

Sign In for Pricing
View Details
Pigeon Tenascin C ELISA Kit
MBS098627-04 10x 96 Well

Pigeon Tenascin C ELISA Kit

Sign In for Pricing
View Details
Cold Filter Plugging Point Filter
52-LTT102 1 Unit

Cold Filter Plugging Point Filter

Sign In for Pricing
View Details
IFluor® 750 Anti-human/ non-human primates CD89 Antibody *A59*
108900L1-AAT 500 Tests

IFluor® 750 Anti-human/ non-human primates CD89 Antibody *A59*

Sign In for Pricing
View Details