Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Psmc1 Peptide - C-terminal region

Psmc1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI325227, P26s4, S4

UniProt

P62192

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Psmc1 Rabbit Polyclonal Antibody (orb583178) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032973

Preservative

Lyophilized powder

AA Sequence

ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAST3 Antibody
E93670 100 µg

MAST3 Antibody

Sign In for Pricing
View Details
USP22 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV670358 1.0 µg DNA

USP22 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
ANXA2 Antibody
OAEB01098-100UG 100 µg

ANXA2 Antibody

Sign In for Pricing
View Details
Zmym4 Rat shRNA Plasmid (Locus ID 313598)
TL706528 1 Kit

Zmym4 Rat shRNA Plasmid (Locus ID 313598)

Sign In for Pricing
View Details
TRBP Recombinant Antibody, PE-Cy7 Conjugated
bsm-61820R-PE-Cy7-TR 20 µL

TRBP Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Recombinant Synaptophysin Antibody / SYP
V9165-100UG 100 µg

Recombinant Synaptophysin Antibody / SYP

Sign In for Pricing
View Details