Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMC3 Peptide - N-terminal region

PSMC3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC8487, TBP1

UniProt

P17980

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMC3 Rabbit Polyclonal Antibody (orb583904) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002795

Preservative

Lyophilized powder

AA Sequence

KDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Texas Red Conjugated Goat Affinity Purified Antibody to Rat IgG (min.x Hu., Bov., Eq.)
TAF-462-1 1 mL

Texas Red Conjugated Goat Affinity Purified Antibody to Rat IgG (min.x Hu., Bov., Eq.)

Sign In for Pricing
View Details
Recombinant FOXF1 Antibody
RC-16180-01 50 μL

Recombinant FOXF1 Antibody

Sign In for Pricing
View Details
Recombinant FOXF1 Antibody
RC-16180-02 100 µL

Recombinant FOXF1 Antibody

Sign In for Pricing
View Details
Recombinant FOXF1 Antibody
RC-16180-03 1 mL

Recombinant FOXF1 Antibody

Sign In for Pricing
View Details
LIM domain only 3 (LMO3) (NM_018640) Human Recombinant Protein
TP305190M 100 µg

LIM domain only 3 (LMO3) (NM_018640) Human Recombinant Protein

Sign In for Pricing
View Details
OR10AD1 (NM_001004134) Human Over-expression Lysate
LY424069 100 µg

OR10AD1 (NM_001004134) Human Over-expression Lysate

Sign In for Pricing
View Details