Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMC3 Peptide - N-terminal region

PSMC3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC8487, TBP1

UniProt

P17980

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMC3 Rabbit Polyclonal Antibody (orb583904) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002795

Preservative

Lyophilized powder

AA Sequence

KDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fenvalerate
TRC-F279450-50MG 50 mg

Fenvalerate

Sign In for Pricing
View Details
Rat CRP Recombinant Rabbit monoclonal Antibody
HA725049 100 µL

Rat CRP Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Acrolein Diethyl Acetal
TRC-A191205-2.5G 2.5 g

Acrolein Diethyl Acetal

Sign In for Pricing
View Details
4-Hydroxy Phenobarbital-d5
TRC-H948962-1MG 1 mg

4-Hydroxy Phenobarbital-d5

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Aegopodium podagraria Lectin (Ground Elder) -APP-
LA-8003-1 1 mg

Alkaline Phosphatase Conjugated Aegopodium podagraria Lectin (Ground Elder) -APP-

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike S1+S2 ECD (D614G) (His Tag)
PKSV030392 100 µg

Recombinant SARS-CoV-2 Spike S1+S2 ECD (D614G) (His Tag)

Sign In for Pricing
View Details