Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMC6 Peptide - C-terminal region

PSMC6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CADP44, MGC12520, P44, SUG2, p42

UniProt

P62333

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002797

Preservative

Lyophilized powder

AA Sequence

GFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HypoGel® 200 SH
SP20011015004.0.25G 25 g

HypoGel® 200 SH

Sign In for Pricing
View Details
IL2 Antibody
KC-409-01 50 μL

IL2 Antibody

Sign In for Pricing
View Details
IL2 Antibody
KC-409-02 100 µL

IL2 Antibody

Sign In for Pricing
View Details
IL2 Antibody
KC-409-03 1 mL

IL2 Antibody

Sign In for Pricing
View Details
Protein A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS
MTB06F4-PA 10x 96 Well Plates

Protein A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS

Sign In for Pricing
View Details
Human TUT7 activation kit by CRISPRa
GA112535 1 Kit

Human TUT7 activation kit by CRISPRa

Sign In for Pricing
View Details