Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD12 Peptide - N-terminal region

PSMD12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC75406, p55, Rpn5

UniProt

O00232

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMD12 Rabbit Polyclonal Antibody (orb583738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002807

Preservative

Lyophilized powder

AA Sequence

MADGGSERADGRIVKMEVDYSATVDQRLPECAKLAKEGRLQEVIETLLSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphoric Acid Dibenzyl Ester-d10
TRC-P359407-2.5MG 2.5 mg

Phosphoric Acid Dibenzyl Ester-d10

Sign In for Pricing
View Details
BCAR1 Rabbit Polyclonal Antibody
AP20260PU-N 100 µg

BCAR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CaMKII (phospho T287) Antibody
KC-4426-01 50 μL

CaMKII (phospho T287) Antibody

Sign In for Pricing
View Details
CaMKII (phospho T287) Antibody
KC-4426-02 100 µL

CaMKII (phospho T287) Antibody

Sign In for Pricing
View Details
CaMKII (phospho T287) Antibody
KC-4426-03 1 mL

CaMKII (phospho T287) Antibody

Sign In for Pricing
View Details
SDHC Human Knockdown Lysate
LY300426 100 µg

SDHC Human Knockdown Lysate

Sign In for Pricing
View Details