Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD12 Peptide - N-terminal region

PSMD12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC75406, p55, Rpn5

UniProt

O00232

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMD12 Rabbit Polyclonal Antibody (orb583738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002807

Preservative

Lyophilized powder

AA Sequence

MADGGSERADGRIVKMEVDYSATVDQRLPECAKLAKEGRLQEVIETLLSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FHL1 Human Gene Knockout Kit (CRISPR)
KN203478BN 1 Kit

FHL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Hydroxyphenone
TRC-H829320-5G 5 g

2-Hydroxyphenone

Sign In for Pricing
View Details
CK-8 Polyclonal Antibody
E-AB-13908-01 20 µL

CK-8 Polyclonal Antibody

Sign In for Pricing
View Details
CK-8 Polyclonal Antibody
E-AB-13908-02 60 µL

CK-8 Polyclonal Antibody

Sign In for Pricing
View Details
CK-8 Polyclonal Antibody
E-AB-13908-03 120 µL

CK-8 Polyclonal Antibody

Sign In for Pricing
View Details
CK-8 Polyclonal Antibody
E-AB-13908-04 200 µL

CK-8 Polyclonal Antibody

Sign In for Pricing
View Details