PSME2 Peptide - middle region
PSME2 Peptide - middle region
Product Specifications
Product Name Alternative
PA28B, PA28beta, REGbeta
UniProt
Q9UL46
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PSME2 Rabbit Polyclonal Antibody (orb330849) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002809
Preservative
Lyophilized powder
AA Sequence
SKETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIV
More Discoveries
Explore Other Products
Browse additional items from our catalog
DEFB3-1491R 50 µg
Recombinant Rat DEFB3 Protein, His (Fc)-Avi-tagged
Sign In for Pricing
View Details 006127 25 mg
6-Chloro-4- (2-chlorophenyl) -2-quinazolinecarboxylic Acid
Sign In for Pricing
View Details 
MBS6418379-01 0.1 mL
GGA2 (Golgi-associated, Gamma Adaptin Ear Containing, ARF Binding Protein 2, GGA2, FLJ20966, KIAA1080, VEAR) (APC)
Sign In for Pricing
View Details MBS6418379-02 5x 0.1 mL
GGA2 (Golgi-associated, Gamma Adaptin Ear Containing, ARF Binding Protein 2, GGA2, FLJ20966, KIAA1080, VEAR) (APC)
Sign In for Pricing
View Details 