Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSME2 Peptide - middle region

PSME2 Peptide - middle region

Product Specifications

Product Name Alternative

PA28B, PA28beta, REGbeta

UniProt

Q9UL46

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSME2 Rabbit Polyclonal Antibody (orb330849) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002809

Preservative

Lyophilized powder

AA Sequence

SKETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pipette Pasteur
5013150/1 1 Each

Pipette Pasteur

Sign In for Pricing
View Details
PTPLAD1 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2381438 100 µL

PTPLAD1 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Recombinant Human APBB3, GST-tagged
APBB3-9732H 25 µg

Recombinant Human APBB3, GST-tagged

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) gloB Polyclonal Antibody
MBS7139752 Inquire

Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) gloB Polyclonal Antibody

Sign In for Pricing
View Details
5-[4'-Hydroxymethyl- (1,1'-biphenyl) -2-yl]-1-triphenylmethyltetrazole
sc-210253 25 mg

5-[4'-Hydroxymethyl- (1,1'-biphenyl) -2-yl]-1-triphenylmethyltetrazole

Sign In for Pricing
View Details
BLVRA Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
13348064 1.0 µg DNA

BLVRA Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details