Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMG3 Peptide - C-terminal region

PSMG3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C7orf48, MGC10911, PAC3

UniProt

Q9BT73

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMG3 Rabbit Polyclonal Antibody (orb584699) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115678

Preservative

Lyophilized powder

AA Sequence

VLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cannabichromene 25mg
A15497-25 25 mg

Cannabichromene 25mg

Sign In for Pricing
View Details
Frataxin (FXN) Antibody
abx128028-01 100 µL

Frataxin (FXN) Antibody

Sign In for Pricing
View Details
Frataxin (FXN) Antibody
abx128028-02 200 µL

Frataxin (FXN) Antibody

Sign In for Pricing
View Details
Frataxin (FXN) Antibody
abx128028-03 1 mL

Frataxin (FXN) Antibody

Sign In for Pricing
View Details
CD50 (Intercellular Adhesion Molecule, ICAM-3) (MaxLight 405) discontinued
C2406-13A-ML405 100 µL

CD50 (Intercellular Adhesion Molecule, ICAM-3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human RGS13 siRNA
abx931393-01 15 nmol

Human RGS13 siRNA

Sign In for Pricing
View Details