Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSTPIP2 Peptide - middle region

PSTPIP2 Peptide - middle region

Product Specifications

Product Name Alternative

MAYP, MGC34175

UniProt

Q9H939

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSTPIP2 Rabbit Polyclonal Antibody (orb585209) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077748

Preservative

Lyophilized powder

AA Sequence

IMDAIHKQKSLQFKKTMDAKKNYEQKCRDKDEAEQAVSRSANLVNPKQQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2702), CF594 conjugate, 0.1mg/mL
BNC942702-100 1x 100 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2702), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SMOX Human Gene Knockout Kit (CRISPR)
KN400156 1 Kit

SMOX Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Primer Panel
HPP6017D 200x 96 reactions in matrix tubes

Primer Panel

Sign In for Pricing
View Details
ORP8 (OSBPL8) Human Gene Knockout Kit (CRISPR)
KN415324 1 Kit

ORP8 (OSBPL8) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human Interleukin-20/IL-20 Protein
PKSH032630-01 20 µg

Recombinant Human Interleukin-20/IL-20 Protein

Sign In for Pricing
View Details
Recombinant Human Interleukin-20/IL-20 Protein
PKSH032630-02 100 µg

Recombinant Human Interleukin-20/IL-20 Protein

Sign In for Pricing
View Details