Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSTPIP2 Peptide - middle region

PSTPIP2 Peptide - middle region

Product Specifications

Product Name Alternative

MAYP, MGC34175

UniProt

Q9H939

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSTPIP2 Rabbit Polyclonal Antibody (orb585209) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077748

Preservative

Lyophilized powder

AA Sequence

IMDAIHKQKSLQFKKTMDAKKNYEQKCRDKDEAEQAVSRSANLVNPKQQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM24 (NM_001143942) Human Over-expression Lysate
LC428414 20 µg

RBM24 (NM_001143942) Human Over-expression Lysate

Sign In for Pricing
View Details
1-t-Boc-piperidine-4-spiro-5’-hydantoin
TRC-B663215-250MG 250 mg

1-t-Boc-piperidine-4-spiro-5’-hydantoin

Sign In for Pricing
View Details
THAP9 Rabbit Polyclonal Antibody
TA371557 100 µL

THAP9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(+)-13alpha-Hydroxylupanine
TRC-H943795-1MG 1 mg

(+)-13alpha-Hydroxylupanine

Sign In for Pricing
View Details
WSB2 Rabbit Polyclonal Antibody
TA383350 100 µL

WSB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TAX1BP1 Human Knockdown Lysate
LY300308 100 µg

TAX1BP1 Human Knockdown Lysate

Sign In for Pricing
View Details