Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTER Peptide - N-terminal region

PTER Peptide - N-terminal region

Product Specifications

Product Name Alternative

RPR-1

UniProt

Q96BW5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTER Rabbit Polyclonal Antibody (orb584918) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_109589

Preservative

Lyophilized powder

AA Sequence

NAYSHKENLQLNQETEAIKEELLYFKANGGGALVENTTTGISRDTQTLKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPM1A Antibody Blocking peptide
orb1445176 500 µg

PPM1A Antibody Blocking peptide

Sign In for Pricing
View Details
ETHE1 Antibody, FITC conjugated
CSB-PA007847HC01HU-01 50 µg

ETHE1 Antibody, FITC conjugated

Sign In for Pricing
View Details
ETHE1 Antibody, FITC conjugated
CSB-PA007847HC01HU-02 100 µg

ETHE1 Antibody, FITC conjugated

Sign In for Pricing
View Details
NSC10010 hydrochloride
T24548-01 25 mg

NSC10010 hydrochloride

Sign In for Pricing
View Details
NSC10010 hydrochloride
T24548-02 50 mg

NSC10010 hydrochloride

Sign In for Pricing
View Details
NSC10010 hydrochloride
T24548-03 100 mg

NSC10010 hydrochloride

Sign In for Pricing
View Details