Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTER Peptide - N-terminal region

PTER Peptide - N-terminal region

Product Specifications

Product Name Alternative

RPR-1

UniProt

Q96BW5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTER Rabbit Polyclonal Antibody (orb584918) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_109589

Preservative

Lyophilized powder

AA Sequence

NAYSHKENLQLNQETEAIKEELLYFKANGGGALVENTTTGISRDTQTLKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUD10 Antibody
MBS9520492-01 0.04 mL

NUD10 Antibody

Sign In for Pricing
View Details
NUD10 Antibody
MBS9520492-02 0.1 mL

NUD10 Antibody

Sign In for Pricing
View Details
NUD10 Antibody
MBS9520492-03 0.2 mL

NUD10 Antibody

Sign In for Pricing
View Details
NUD10 Antibody
MBS9520492-04 5x 0.2 mL

NUD10 Antibody

Sign In for Pricing
View Details
ALPP, NT (ALPP, PLAP, Alkaline phosphatase, placental type, Alkaline phosphatase Regan isozyme, Placental alkaline phosphatase 1) (AP) discontinued
031817-AP 200 µL

ALPP, NT (ALPP, PLAP, Alkaline phosphatase, placental type, Alkaline phosphatase Regan isozyme, Placental alkaline phosphatase 1) (AP) discontinued

Sign In for Pricing
View Details
BRSK1 Antibody (C-term)
MBS9202562-01 0.08 mL

BRSK1 Antibody (C-term)

Sign In for Pricing
View Details