Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGDR Peptide - C-terminal region

PTGDR Peptide - C-terminal region

Product Specifications

Product Name Alternative

AS1, ASRT1, DP, DP1, MGC49004, PTGDR1

UniProt

Q13258

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTGDR Rabbit Polyclonal Antibody (orb584973) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000944

Preservative

Lyophilized powder

AA Sequence

FKDVKEKNRTSEEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zscan4d Mouse Gene Knockout Kit (CRISPR)
KN520158 1 Kit

Zscan4d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cathepsin D (Tumor Marker) (CTSD/3276), Biotin conjugate, 0.1mg/mL
BNCB3276-100 1x 100 µL

Cathepsin D (Tumor Marker) (CTSD/3276), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Oxindole-3-acetic Acid
TRC-O850140-500MG 500 mg

Oxindole-3-acetic Acid

Sign In for Pricing
View Details
Aig1 Mouse Gene Knockout Kit (CRISPR)
KN501041 1 Kit

Aig1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p63 (TP63) (NM_003722) Human Recombinant Protein
TP308013 20 µg

p63 (TP63) (NM_003722) Human Recombinant Protein

Sign In for Pricing
View Details
Thymidine Kinase 2 (TK2) (NM_004614) Human Recombinant Protein
TP761242 50 µg

Thymidine Kinase 2 (TK2) (NM_004614) Human Recombinant Protein

Sign In for Pricing
View Details