Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGDR Peptide - C-terminal region

PTGDR Peptide - C-terminal region

Product Specifications

Product Name Alternative

AS1, ASRT1, DP, DP1, MGC49004, PTGDR1

UniProt

Q13258

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTGDR Rabbit Polyclonal Antibody (orb584974) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000944

Preservative

Lyophilized powder

AA Sequence

SCTRDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL-12 p70/IL12A Antibody, Rabbit Polyclonal
MBS8100162-01 0.1 mL

Anti-IL-12 p70/IL12A Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-IL-12 p70/IL12A Antibody, Rabbit Polyclonal
MBS8100162-02 5x 0.1 mL

Anti-IL-12 p70/IL12A Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Rabbit Polyclonal FAM171B Antibody [Janelia Fluor 549]
NBP2-97891JF549 0.1 mL

Rabbit Polyclonal FAM171B Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
IL 8 (1-72)
chm-231 5µg

IL 8 (1-72)

Sign In for Pricing
View Details
Mouse Anti-Bovine Nuclear Respiratory Factor 1 (NRF1) Monoclonal Antibody
VD12N298 1 Each

Mouse Anti-Bovine Nuclear Respiratory Factor 1 (NRF1) Monoclonal Antibody

Sign In for Pricing
View Details
OLIG2 (Oligodendrocyte Lineage Transcription Factor 2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19) (MaxLight 650)
MBS6229062-01 0.1 mL

OLIG2 (Oligodendrocyte Lineage Transcription Factor 2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19) (MaxLight 650)

Sign In for Pricing
View Details