Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGDR Peptide - C-terminal region

PTGDR Peptide - C-terminal region

Product Specifications

Product Name Alternative

AS1, ASRT1, DP, DP1, MGC49004, PTGDR1

UniProt

Q13258

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTGDR Rabbit Polyclonal Antibody (orb584974) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000944

Preservative

Lyophilized powder

AA Sequence

SCTRDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Progesterone R/NR3C3 ELISA Kit (Chemiluminescence)
NBP2-68091 1 Kit

Human Progesterone R/NR3C3 ELISA Kit (Chemiluminescence)

Sign In for Pricing
View Details
PMVK CRISPR All-in-one AAV vector set (with saCas9)(Rat)
37089156 3x 1.0 µg DNA

PMVK CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
TMEM45A Human shRNA Lentiviral Particle (Locus ID 55076)
TL300966V 500 µL Each

TMEM45A Human shRNA Lentiviral Particle (Locus ID 55076)

Sign In for Pricing
View Details
Protein OS-9 (OS9) Antibody
abx455994-01 50 µg

Protein OS-9 (OS9) Antibody

Sign In for Pricing
View Details
Protein OS-9 (OS9) Antibody
abx455994-02 100 µg

Protein OS-9 (OS9) Antibody

Sign In for Pricing
View Details
PNMTP1 sgRNA CRISPR Lentivector set (Human)
K1677501 3x 1.0 µg

PNMTP1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details