Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGES3 Peptide - middle region

PTGES3 Peptide - middle region

Product Specifications

Product Name Alternative

P23, TEBP, cPGES

UniProt

Q15185

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTGES3 Rabbit Polyclonal Antibody (orb583955) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006592

Preservative

Lyophilized powder

AA Sequence

KDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPRE2 Protein Vector (Mouse) (pPB-C-His)
PV199222 500 ng

MAPRE2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
HDAC1 (S421) (Histone Deacetylase 1, HD1, RPD3L1) (FITC) discontinued
H1827-50J2-FITC 200 µL

HDAC1 (S421) (Histone Deacetylase 1, HD1, RPD3L1) (FITC) discontinued

Sign In for Pricing
View Details
Mfap5 3'UTR GFP Stable Cell Line
TU263106 1.0 mL

Mfap5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
DCL-1 Polyclonal Antibody
MBS9402853-01 0.05 mL

DCL-1 Polyclonal Antibody

Sign In for Pricing
View Details
DCL-1 Polyclonal Antibody
MBS9402853-02 0.1 mL

DCL-1 Polyclonal Antibody

Sign In for Pricing
View Details
DCL-1 Polyclonal Antibody
MBS9402853-03 5x 0.1 mL

DCL-1 Polyclonal Antibody

Sign In for Pricing
View Details