Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGES3 Peptide - middle region

PTGES3 Peptide - middle region

Product Specifications

Product Name Alternative

P23, TEBP, cPGES

UniProt

Q15185

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTGES3 Rabbit Polyclonal Antibody (orb583955) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006592

Preservative

Lyophilized powder

AA Sequence

KDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFNB3 Peptide - C-terminal region
orb2007759 100 µg

EFNB3 Peptide - C-terminal region

Sign In for Pricing
View Details
KDM4A Antibody
orb43315-01 50 µg

KDM4A Antibody

Sign In for Pricing
View Details
KDM4A Antibody
orb43315-02 100 µg

KDM4A Antibody

Sign In for Pricing
View Details
CD4 discontinued
590083 200 µg

CD4 discontinued

Sign In for Pricing
View Details
Human Phosphoglucomutase 3 (PGM3) ELISA Kit
MBS9303087-01 48 Well

Human Phosphoglucomutase 3 (PGM3) ELISA Kit

Sign In for Pricing
View Details
Human Phosphoglucomutase 3 (PGM3) ELISA Kit
MBS9303087-02 96 Well

Human Phosphoglucomutase 3 (PGM3) ELISA Kit

Sign In for Pricing
View Details