Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pthlh Peptide - middle region

Pthlh Peptide - middle region

Product Specifications

Product Name Alternative

PTH-like, Pthrp

UniProt

P22858

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pthlh Rabbit Polyclonal Antibody (orb574867) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_032996

Preservative

Lyophilized powder

AA Sequence

EVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uracil
TRC-U801000-5G 5 g

Uracil

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2442), CF594 conjugate, 0.1mg/mL
BNC942442-500 1x 500 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2442), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Camostat mesylate
SIH-585-10MG 10 mg

Camostat mesylate

Sign In for Pricing
View Details
Precision Balance BBAL-225
BBAL-225 1 Unit

Precision Balance BBAL-225

Sign In for Pricing
View Details
Zmiz2 Mouse Gene Knockout Kit (CRISPR)
KN520107 1 Kit

Zmiz2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAB2B (NM_001163380) Human Over-expression Lysate
LC431135 20 µg

RAB2B (NM_001163380) Human Over-expression Lysate

Sign In for Pricing
View Details