Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pthlh Peptide - middle region

Pthlh Peptide - middle region

Product Specifications

Product Name Alternative

PTH-like, Pthrp

UniProt

P22858

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pthlh Rabbit Polyclonal Antibody (orb574867) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_032996

Preservative

Lyophilized powder

AA Sequence

EVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LINGO1 activation kit by CRISPRa
GA113746 1 Kit

Human LINGO1 activation kit by CRISPRa

Sign In for Pricing
View Details
ZNF330 Human Gene Knockout Kit (CRISPR)
KN400336 1 Kit

ZNF330 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF647 conjugate, 0.1mg/mL
BNC472831-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,3-O-Isopropylidene-L-lyxono-1,4-lactone
TRC-I868650-25MG 25 mg

2,3-O-Isopropylidene-L-lyxono-1,4-lactone

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF405S conjugate, 0.1mg/mL
BNC041526-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAB3IP Rabbit Polyclonal Antibody
TA366454 100 µL

RAB3IP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details