Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTP4A3 Peptide - C-terminal region

PTP4A3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PRL-3, PRL-R, PRL3

UniProt

O75365

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTP4A3 Rabbit Polyclonal Antibody (orb580394) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116000

Preservative

Lyophilized powder

AA Sequence

MKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Sacsin Antibody Picoband® (Biotine Conjugate)
A00519-Biotin 100 µg/Vial

Anti-Sacsin Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Phospho-KLF5 (Ser311) Rabbit Polyclonal Antibody (PE-Cy5)
orb885847 100 µL

Phospho-KLF5 (Ser311) Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
S100A8/A9 Mouse Monoclonal Antibody [Clone:9B1]
E45M21532 100 µg

S100A8/A9 Mouse Monoclonal Antibody [Clone:9B1]

Sign In for Pricing
View Details
RAB14 Antibody
E037854 100 µg -100 µL

RAB14 Antibody

Sign In for Pricing
View Details
Ub, acetylated (K33) discontinued
347598-01 100 µL

Ub, acetylated (K33) discontinued

Sign In for Pricing
View Details
Ub, acetylated (K33) discontinued
347598-02 200 µL

Ub, acetylated (K33) discontinued

Sign In for Pricing
View Details