Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPN3 Peptide - N-terminal region

PTPN3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686N0569, PTPH1, PTP-H1

UniProt

E9PGU7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTPN3 Rabbit Polyclonal Antibody (orb331150) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138841

Preservative

Lyophilized powder

AA Sequence

ASAGVAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Conserved virulence factor B (cvfB)
MBS1385261-01 0.02 mg (E-Coli)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Conserved virulence factor B (cvfB)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus Conserved virulence factor B (cvfB)
MBS1385261-02 0.02 mg (Yeast)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Conserved virulence factor B (cvfB)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus Conserved virulence factor B (cvfB)
MBS1385261-03 0.1 mg (E-Coli)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Conserved virulence factor B (cvfB)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus Conserved virulence factor B (cvfB)
MBS1385261-04 0.1 mg (Yeast)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Conserved virulence factor B (cvfB)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus Conserved virulence factor B (cvfB)
MBS1385261-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Conserved virulence factor B (cvfB)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus Conserved virulence factor B (cvfB)
MBS1385261-06 0.02 mg (Mammalian-Cell)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Conserved virulence factor B (cvfB)

Sign In for Pricing
View Details