Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPN3 Peptide - N-terminal region

PTPN3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686N0569, PTPH1, PTP-H1

UniProt

E9PGU7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTPN3 Rabbit Polyclonal Antibody (orb331150) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138841

Preservative

Lyophilized powder

AA Sequence

ASAGVAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDH2 Antibody
MBS8500504-01 0.1 mL

CDH2 Antibody

Sign In for Pricing
View Details
CDH2 Antibody
MBS8500504-02 0.1 mL (AF405L)

CDH2 Antibody

Sign In for Pricing
View Details
CDH2 Antibody
MBS8500504-03 0.1 mL (AF405S)

CDH2 Antibody

Sign In for Pricing
View Details
CDH2 Antibody
MBS8500504-04 0.1 mL (AF610)

CDH2 Antibody

Sign In for Pricing
View Details
CDH2 Antibody
MBS8500504-05 0.1 mL (AF635)

CDH2 Antibody

Sign In for Pricing
View Details
CDH2 Antibody
MBS8500504-06 0.1 mL (APC)

CDH2 Antibody

Sign In for Pricing
View Details