Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTX3 Peptide - N-terminal region

PTX3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TNFAIP5, TSG-14

UniProt

P26022

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTX3 Rabbit Polyclonal Antibody (orb583188) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002843

Preservative

Lyophilized powder

AA Sequence

MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZZZ3 shRNA Plasmid
abx958649-01 150 µg

Human ZZZ3 shRNA Plasmid

Sign In for Pricing
View Details
Human ZZZ3 shRNA Plasmid
abx958649-02 300 µg

Human ZZZ3 shRNA Plasmid

Sign In for Pricing
View Details
Sheep Phosphatidylinositol 4-Kinase Catalytic Alpha ELISA Kit
MBS005345-01 48 Well

Sheep Phosphatidylinositol 4-Kinase Catalytic Alpha ELISA Kit

Sign In for Pricing
View Details
Sheep Phosphatidylinositol 4-Kinase Catalytic Alpha ELISA Kit
MBS005345-02 96 Well

Sheep Phosphatidylinositol 4-Kinase Catalytic Alpha ELISA Kit

Sign In for Pricing
View Details
Sheep Phosphatidylinositol 4-Kinase Catalytic Alpha ELISA Kit
MBS005345-03 5x 96 Well

Sheep Phosphatidylinositol 4-Kinase Catalytic Alpha ELISA Kit

Sign In for Pricing
View Details
Sheep Phosphatidylinositol 4-Kinase Catalytic Alpha ELISA Kit
MBS005345-04 10x 96 Well

Sheep Phosphatidylinositol 4-Kinase Catalytic Alpha ELISA Kit

Sign In for Pricing
View Details