Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pura Peptide - C-terminal region

Pura Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAGER-1, Pur-alpha, ssCRE-BP

UniProt

P42669

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pura Rabbit Polyclonal Antibody (orb576791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033015

Preservative

Lyophilized powder

AA Sequence

KPTYRNSITVPYKVWAKFGHTFCKYSEEMKKIQEKQREKRAACEQLHQQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wilms Tumor 1 (WT1) Rabbit anti-Human Polyclonal (C-Terminus) Antibody
GWB-132377 0.05 mg

Wilms Tumor 1 (WT1) Rabbit anti-Human Polyclonal (C-Terminus) Antibody

Sign In for Pricing
View Details
pCMV-SPORT6-Ptpn2 Plasmid
PVT42605 2 µg

pCMV-SPORT6-Ptpn2 Plasmid

Sign In for Pricing
View Details
CALM1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV685621 1.0 µg DNA

CALM1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Phosphotyrosine (P-Tyr) (PY2870R), CF594 conjugate, 0.1mg/mL
BNC942870-100 1x 100 µL

Phosphotyrosine (P-Tyr) (PY2870R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TREH (Trehalase (brush-border Membrane Glycoprotein), MGC129621, TRE, TREA) (APC)
252962-APC 100 µL

TREH (Trehalase (brush-border Membrane Glycoprotein), MGC129621, TRE, TREA) (APC)

Sign In for Pricing
View Details
Human Zinc finger matrin-type protein 4, ZMAT4 ELISA KIT
ELI-22603h 96 Tests

Human Zinc finger matrin-type protein 4, ZMAT4 ELISA KIT

Sign In for Pricing
View Details