Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pura Peptide - C-terminal region

Pura Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAGER-1, Pur-alpha, ssCRE-BP

UniProt

P42669

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pura Rabbit Polyclonal Antibody (orb576791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033015

Preservative

Lyophilized powder

AA Sequence

KPTYRNSITVPYKVWAKFGHTFCKYSEEMKKIQEKQREKRAACEQLHQQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Ankyrin repeat domain containing protein 37 (ANKRD37) ELISA Kit
GTR10327966 96 Well

Canine Ankyrin repeat domain containing protein 37 (ANKRD37) ELISA Kit

Sign In for Pricing
View Details
Atxn7l3 (NM_001098836) Mouse Tagged ORF Clone Lentiviral Particle
MR220280L4V 200 µL

Atxn7l3 (NM_001098836) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal EpCAM/TROP1 Antibody (EGP40/1798) [DyLight 405]
NBP2-54456V 100 µL

Mouse Monoclonal EpCAM/TROP1 Antibody (EGP40/1798) [DyLight 405]

Sign In for Pricing
View Details
FTCD Recombinant Antibody, FITC Conjugated
bsm-61401R-FITC-01 20 µL

FTCD Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
FTCD Recombinant Antibody, FITC Conjugated
bsm-61401R-FITC-02 100 µL

FTCD Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
TUBA4A Monoclonal Antibody
E10-32012 100 µg -100 µL

TUBA4A Monoclonal Antibody

Sign In for Pricing
View Details