Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PUS1 Peptide - N-terminal region

PUS1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC11268, MLASA1

UniProt

E5KMT6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PUS1 Rabbit Polyclonal Antibody (orb585100) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001002019

Preservative

Lyophilized powder

AA Sequence

LVSALVRSGCIPENHGEDMRKMSFQRCARTDKGVSAAGQVVSLKVWLIDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UPF0461 Protein C5orf24 (C5ORF24) Antibody (HRP)
abx308360-01 20 µg

UPF0461 Protein C5orf24 (C5ORF24) Antibody (HRP)

Sign In for Pricing
View Details
UPF0461 Protein C5orf24 (C5ORF24) Antibody (HRP)
abx308360-02 50 µg

UPF0461 Protein C5orf24 (C5ORF24) Antibody (HRP)

Sign In for Pricing
View Details
UPF0461 Protein C5orf24 (C5ORF24) Antibody (HRP)
abx308360-03 100 µg

UPF0461 Protein C5orf24 (C5ORF24) Antibody (HRP)

Sign In for Pricing
View Details
UPF0461 Protein C5orf24 (C5ORF24) Antibody (HRP)
abx308360-04 200 µg

UPF0461 Protein C5orf24 (C5ORF24) Antibody (HRP)

Sign In for Pricing
View Details
UPF0461 Protein C5orf24 (C5ORF24) Antibody (HRP)
abx308360-05 1 mg

UPF0461 Protein C5orf24 (C5ORF24) Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum D-tagatose-1,6-bisphosphate aldolase subunit gatZ (gatZ)
MBS1139215-01 0.02 mg (E-Coli)

Recombinant Salmonella gallinarum D-tagatose-1,6-bisphosphate aldolase subunit gatZ (gatZ)

Sign In for Pricing
View Details