Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PUS1 Peptide - N-terminal region

PUS1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC11268, MLASA1

UniProt

E5KMT6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PUS1 Rabbit Polyclonal Antibody (orb585100) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001002019

Preservative

Lyophilized powder

AA Sequence

LVSALVRSGCIPENHGEDMRKMSFQRCARTDKGVSAAGQVVSLKVWLIDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pig Monocyte Chemotactic Protein 2 (MCP2)
RPU54451-01 50 µg

Recombinant Pig Monocyte Chemotactic Protein 2 (MCP2)

Sign In for Pricing
View Details
Recombinant Pig Monocyte Chemotactic Protein 2 (MCP2)
RPU54451-02 100 µg

Recombinant Pig Monocyte Chemotactic Protein 2 (MCP2)

Sign In for Pricing
View Details
Recombinant Pig Monocyte Chemotactic Protein 2 (MCP2)
RPU54451-03 1 mg

Recombinant Pig Monocyte Chemotactic Protein 2 (MCP2)

Sign In for Pricing
View Details
Rabbit A kinase anchor protein 7 isoforms Alpha and β (AKAP7) ELISA kit
GTR10448963 96 Well

Rabbit A kinase anchor protein 7 isoforms Alpha and β (AKAP7) ELISA kit

Sign In for Pricing
View Details
CTRP3 (C1QTNF3) (NM_181435) Human Tagged Lenti ORF Clone
RC213742L3 10 µg

CTRP3 (C1QTNF3) (NM_181435) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Olfr1016 3'UTR Lenti-reporter-Luc Vector
32516084 1.0 µg

Olfr1016 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details