Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PVR Peptide - N-terminal region

PVR Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD155, FLJ25946, HVED, NECL5, Necl-5, PVS, TAGE4

UniProt

P15151

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PVR Rabbit Polyclonal Antibody (orb585504) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_006496

Preservative

Lyophilized powder

AA Sequence

FHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE3A Monoclonal Antibody
E53M02312 100 µL

UBE3A Monoclonal Antibody

Sign In for Pricing
View Details
NT5C1B siRNA (Mouse)
orb1840944-01 15 nmol

NT5C1B siRNA (Mouse)

Sign In for Pricing
View Details
NT5C1B siRNA (Mouse)
orb1840944-02 30 nmol

NT5C1B siRNA (Mouse)

Sign In for Pricing
View Details
Olfr340 sgRNA CRISPR Lentivector set (Mouse)
K4227301 3x 1.0 µg

Olfr340 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal TLE1 Antibody (TLE1/2085)
NBP3-07727-100ug 100 µg

Mouse Monoclonal TLE1 Antibody (TLE1/2085)

Sign In for Pricing
View Details
SDF2L1 sgRNA CRISPR Lentivector (Human) (Target 3)
K2108704 1.0 µg DNA

SDF2L1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details