Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PVR Peptide - N-terminal region

PVR Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD155, FLJ25946, HVED, NECL5, Necl-5, PVS, TAGE4

UniProt

P15151

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PVR Rabbit Polyclonal Antibody (orb585504) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_006496

Preservative

Lyophilized powder

AA Sequence

FHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Coagulation factor 9, F9 ELISA KIT
EA0029Rb-01 96 Well

Rabbit Coagulation factor 9, F9 ELISA KIT

Sign In for Pricing
View Details
Phaseolus limensis (LBA) (FITC) discontinued
518610 2 mg

Phaseolus limensis (LBA) (FITC) discontinued

Sign In for Pricing
View Details
S200 96-well PCR Plate Adapter
E5392070038 1 Each

S200 96-well PCR Plate Adapter

Sign In for Pricing
View Details
ITGB3 ELISA Kit (Human)
OKEH07018-96W 96 Tests

ITGB3 ELISA Kit (Human)

Sign In for Pricing
View Details
EIF2S2P5 AAV Vector (Human) (CMV)
19100101 1 µg

EIF2S2P5 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Monkey Cytoglobin (CYGB) ELISA kit
GTR10429160 96 Well

Monkey Cytoglobin (CYGB) ELISA kit

Sign In for Pricing
View Details