Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NECTIN1 Peptide - N-terminal region

NECTIN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ED4, PRR, HIgR, HV1S, HVEC, OFC7, PRR1, PVRR, CD111, PVRL1, PVRR1, SK-12, CLPED1, nectin-1

UniProt

Q15223

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NECTIN1 Rabbit Polyclonal Antibody (orb584981) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002846

Preservative

Lyophilized powder

AA Sequence

QLNLTVMAKPTNWIEGTQAVLRAKKGQDDKVLVATCTSANGKPPSVVSWE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDN2 (Claudin-2, SP82, PSEC0059, SP82, UNQ705/PRO1356) (PE)
MBS6157144-01 0.1 mL

CLDN2 (Claudin-2, SP82, PSEC0059, SP82, UNQ705/PRO1356) (PE)

Sign In for Pricing
View Details
CLDN2 (Claudin-2, SP82, PSEC0059, SP82, UNQ705/PRO1356) (PE)
MBS6157144-02 5x 0.1 mL

CLDN2 (Claudin-2, SP82, PSEC0059, SP82, UNQ705/PRO1356) (PE)

Sign In for Pricing
View Details
DIO2, ID (Type II iodothyronine deiodinase, Type-II 5'-deiodinase, Type 2 DI, DIOII, 5DII, TXDI2, ITDI2, DIO2) (MaxLight 490) discontinued
D3714-20A-ML490 100 µL

DIO2, ID (Type II iodothyronine deiodinase, Type-II 5'-deiodinase, Type 2 DI, DIOII, 5DII, TXDI2, ITDI2, DIO2) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Human CD223 protein, C-His Tag
MBS1560004-01 0.05 mg

Recombinant Human CD223 protein, C-His Tag

Sign In for Pricing
View Details
Recombinant Human CD223 protein, C-His Tag
MBS1560004-02 0.1 mg

Recombinant Human CD223 protein, C-His Tag

Sign In for Pricing
View Details
Recombinant Human CD223 protein, C-His Tag
MBS1560004-03 1 mg

Recombinant Human CD223 protein, C-His Tag

Sign In for Pricing
View Details