NECTIN1 Peptide - N-terminal region
NECTIN1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ED4, PRR, HIgR, HV1S, HVEC, OFC7, PRR1, PVRR, CD111, PVRL1, PVRR1, SK-12, CLPED1, nectin-1
UniProt
Q15223
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NECTIN1 Rabbit Polyclonal Antibody (orb584981) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002846
Preservative
Lyophilized powder
AA Sequence
QLNLTVMAKPTNWIEGTQAVLRAKKGQDDKVLVATCTSANGKPPSVVSWE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Human PANK4 Matched Antibody Pair Set [IV1189/RD1172-Biotin]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
Z01LS-1122-LS598 5 Plates
Human PANK4 Matched Antibody Pair Set [IV1189/RD1172-Biotin]
Sign In for Pricing
View Details OV8011a 1 Each
Epithelial ovarian carcinoma (EOC) tissue array with normal adjacent tissue (NAT) , including pathology grade, TNM and clinical stage (AJCC 8th edition), 80 cases/80 cores (core size 1.5mm), replacing OV8011
Sign In for Pricing
View Details